PDBID: | 9d3b | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d3c | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d2v | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d32 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the HKU5 RBD bound to the P. abramus ACE2 receptor | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | Deposition date: | 2024-08-09 |
|
PDBID: | 9d2o | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d31 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d33 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d3f | Status: | HPUB -- hold until publication | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | Authors: | Akella, R., Goldsmith, E.J. | Deposition date: | 2024-08-09 | Sequence: | >Entity 1 QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQERKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEET
|
|
PDBID: | 9d2w | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d2p | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-09 |
|
PDBID: | 9d2u | Status: | HPUB -- hold until publication | Title: | Crystal structure of KPC-2 complexed with compound 13 | Authors: | Jacobs, L.M.C., Chen, Y. | Deposition date: | 2024-08-09 |
|
PDBID: | 9d2x | Status: | AUTH -- processed, waiting for author review and approval | Title: | SpiD ETS-domain (168-273) in complex with the DNA sequence d(AATAAAAGGAAGTGGG) | Authors: | Terrell, J.R., Vernon, T.N., Poon, G.M.K. | Deposition date: | 2024-08-09 |
|
PDBID: | 9j48 | Status: | HPUB -- hold until publication | Title: | GFP bound to 24-mer DARPin-apoferritin model 6c | Authors: | Lu, X., Yan, M., Zhang, H.M., Hao, Q. | Deposition date: | 2024-08-09 |
|
PDBID: | 9gf1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-08 |
|
PDBID: | 9gez | Status: | HPUB -- hold until publication | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""waiting"" position | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf2 | Status: | HPUB -- hold until publication | Title: | This peptide is a variant of the de novo hexameric peptide, CC-Hex2, which consists of 4 heptad repeats. This peptide has been denoted CC-Hex2 as its second heptad repeat has been replaced with a hendecad repeat. | Authors: | Kurgan, K.W., Martin, F.J.O., Woolfson, D.N. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf3 | Status: | HPUB -- hold until publication | Title: | This peptide is a variant of the de novo coiled-coil heptameric peptic, CC-Hept, which consists of 4 heptad repeats. This peptide is denoted as CC-Hept-hen2 as its second heptad repeat has been replaced with a hendecad repeat. | Authors: | Kurgan, K.W., Martin, F.J.O. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf4 | Status: | HPUB -- hold until publication | Title: | This peptide is a variant of the previously designed de novo heptameric coiled-coil, CC-Hept-IV, which consists of 4 heptad repeats. We have denoted this de novo peptide CC-Hept-IV-hen2 as it includes a noncanonical, hendecad repeat which replaces the second heptad repeat in the original CC-Hept-IV sequence. | Authors: | Kurgan, K.W., Martin, F.J.O., Woolfson, D.N. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf0 | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of Pentameric Outer Membrane Protein A from Bdellovibrio bacteriovorus | Authors: | Parr, R.J., Ratkeviciute, G., Lovering, A.L. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gfa | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | S-Protease complexed with stapled peptide-like ligand | Authors: | Perdriau, C., Luton, A., Zimmeter, K., Neuville, M., Saragaglia, C., Peluso-lltis, C., Osz, J., Kauffmann, B., Collie, G., Rochel, N., Guichard, G., Pasco, M. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf5 | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF COMPLEX OF ASO BINDING FAB FRAGMENT IN COMPLEX WITH ASO980 | Authors: | Hung-En, H., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirth, T., Benz, J., Georges, G., Langer, M., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gf6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-08 |
|