| PDBID: | 9dji | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 4j8i | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparin dp24 | | Authors: | Khan, S., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-02-14 | | Release date: | 2020-02-14 |
|
| PDBID: | 9djj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8j4n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 4j8j | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparin dp30 | | Authors: | Khan, S., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-02-14 | | Release date: | 2020-02-14 |
|
| PDBID: | 9dj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HUMAN VH1-RELATED DUAL-SPECIFICITY PHOSPHATASE (VHR) in distinct apo form | | Authors: | Keedy, D.A., Lemberikman, A.M., Isiorho, E.A., Aleshin, A.E., Wu, J., Lambert, L.J., Cosford, N.D.P., Tautz, L. | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8j4o | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of the Acinetobacter baumannii LysR family regulator AceR effector-binding domain with Spermidine | | Authors: | Ma, J.M., Ge, H.H. | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 4j8k | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparin dp36 | | Authors: | Khan, S., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-02-14 | | Release date: | 2020-02-14 |
|
| PDBID: | 9djk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 9djl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8yvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9djm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8otu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-24 |
|
| PDBID: | 8yvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9djn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8j4v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 8yv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 9djw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 8yva | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8j4w | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Mycobacterium thermoresistibile NrdI(reduced) determined at 1.1 angstrom resolution | | Authors: | Yadav, L.R., Mande, S.C. | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 9div | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of de novo designed ChuA binding protein C8 | | Authors: | Fox, D., Grinter, R. | | Deposition date: | 2024-09-06 |
|
