PDBID: | 9f5r | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MGSSHHHHHHSAALEVLFQGPHMWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
|
|
PDBID: | 8y5x | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 9f5t | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y5y | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 9f5x | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 9f5y | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y61 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 9f5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of open state ferulic acid decarboxylase from Saccharomyces cerevisiae, F397V/I398L/T438P/P441V mutant | Authors: | Feng, Y.B., Song, X., Zhu, X.N. | Deposition date: | 2024-02-01 |
|
PDBID: | 8y68 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 9f60 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f61 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y67 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 9f67 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y6e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-02 |
|
PDBID: | 9f68 | Status: | HOLD -- hold until a certain date | Title: | Human Interleukin-31 in complex with Oncostatin-M receptor | Authors: | Bloch, Y., Savvides, S.N. | Deposition date: | 2024-04-30 | Release date: | 2025-10-30 |
|
PDBID: | 8y69 | Status: | AUTH -- processed, waiting for author review and approval | Title: | LGR4-RSPO2-ZNRF3 (2:2:2) | Authors: | Wang, L. | Deposition date: | 2024-02-02 |
|
PDBID: | 8y6g | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 9f5w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 8y6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 9f62 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 9f5u | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5v | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|