| PDBID: | 9ep5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase from Environmental sample (99.2% identity to Myxococcus fulvus enzyme) | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8wkm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8jbt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-09 | | Release date: | 2024-08-09 |
|
| PDBID: | 9ep6 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Fusarium solani | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9epc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wky | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8wkz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Melanocortin-4 Receptor (MC4R) in complex with S31 | | Authors: | Gimenez, L.E., Martin, C., Yu, J., Hollanders, C., Hernandez, C., Dahir, N.S., Wu, Y., Yao, D., Han, G.W., Wu, L., Poorten, O.V., Lamouroux, A., Mannes, M., Tourwe, D., Zhao, S., Stevens, R.C., Cone, R.D., Ballet, S. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8wkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wkv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wbz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-10 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wlv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P122A_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DelP123_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P123A_Msd | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
