| PDBID: | 9bni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8uic | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8uib | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9bnp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody V033-a.01 in complex with HIV-1 Env BG505 DS-SOSIP | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody V031-a.01 in complex with HIV-1 Env BG505 DS-SOSIP | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody 44715-a.01 in complex with HIV-1 Env BG505 DS-SOSIP | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8t3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-08 | | Release date: | 2024-12-04 |
|
| PDBID: | 9bnl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody 6070-a.01 in complex with HIV-1 Env Q23.17 MD39 SOSIP | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8ubs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NrdJ-1 split intein fusion | | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubq | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-24 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 9bme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8ul7 | | Status: | HPUB -- hold until publication | | Title: | The structure of NanH in complex with Neu5Ac | | Authors: | Medley, B.J., Boraston, A.B. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 9bnt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8ul9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 9bns | | Status: | HPUB -- hold until publication | | Title: | Rhesus macaque ITS114.01 Fab in complex with SIV MPER peptide | | Authors: | Gorman, J., Lai, Y.-T., Kwong, P.D. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bnu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8ucj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9bnv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8uck | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9bnw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8ucl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8zvp | | Status: | HPUB -- hold until publication | | Title: | Human SIRT6 in complex with EGCG | | Authors: | Song, B., Wang, Y. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8ucm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8zvl | | Status: | HPUB -- hold until publication | | Title: | human citrate synthases complexed with oxaloacetate | | Authors: | Yang, L.Y., Fang, Y.J. | | Deposition date: | 2024-06-11 |
|
