PDBID: | 8zed | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-05 |
|
PDBID: | 8zec | Status: | HPUB -- hold until publication | Title: | AtoB in complex with substrate analogue | Authors: | Ma, K., Fan, A., Lin, W. | Deposition date: | 2024-05-05 |
|
PDBID: | 8zeh | Status: | HPUB -- hold until publication | Title: | PSI-FCPI-L in Thalassiosira pseudonana | Authors: | Feng, Y., Li, Z., Wang, W., Shen, J.R. | Deposition date: | 2024-05-06 |
|
PDBID: | 8zer | Status: | HPUB -- hold until publication | Title: | Crystal structure of the complex of Wuhan SARS-CoV-2 RBD (319-541) with P2C5 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u3p | Status: | HPUB -- hold until publication | Title: | 1.79 Angstrom resolution crystal structure of KatG from Mycobacterium tuberculosis with an MYW cofactor after heat incubation for 60 minutes | Authors: | Liu, A., Li, J., Ran, D. | Deposition date: | 2023-09-08 |
|
PDBID: | 8zeg | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-06 |
|
PDBID: | 8u3s | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-08 |
|
PDBID: | 8zej | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-06 |
|
PDBID: | 8u40 | Status: | HPUB -- hold until publication | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | Authors: | Chen, P., Arutyunova, E., Lu, J., Young, H.S., Lemieux, M.J. | Deposition date: | 2023-09-08 |
|
PDBID: | 8zet | Status: | HPUB -- hold until publication | Title: | Tp-PSI-FCPI-S in Thalassiosira pseudonana | Authors: | Feng, Y., Li, Z., Shen, J.R., Wang, W. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u4h | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-10 |
|
PDBID: | 8zef | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-06 |
|
PDBID: | 8u4g | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-10 |
|
PDBID: | 8zei | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase with crystal soaked in beta-alanyl histidine | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u4m | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-10 |
|
PDBID: | 8zel | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase Tyr314Phe mutant with a crystal soaked in beta-alanyl ornithine | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u4y | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-09-11 |
|
PDBID: | 8zes | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Wuhan SARS-CoV-2 RBD (333-541) complexed with P2C5 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u52 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | Deposition date: | 2023-09-11 |
|
PDBID: | 8zeq | Status: | HPUB -- hold until publication | Title: | Structural insights into human glycogen debranching enzyme (GDE) | Authors: | Guan, H., Chen, H. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u5l | Status: | HPUB -- hold until publication | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8zeo | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD1 complex | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8zep | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD2 complex | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | Deposition date: | 2024-05-06 |
|