PDBID: | 8toz | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8z8h | Status: | HPUB -- hold until publication | Title: | The complex structure of HnH6H, 2OG and hyoscyamine. | Authors: | Wu, L., Zhou, J.H. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tpw | Status: | HPUB -- hold until publication | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: cis-oriented 1B2 and ACP | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-08-05 |
|
PDBID: | 8z8i | Status: | HPUB -- hold until publication | Title: | The quaternary complex structure of HnH6H, iron,AKG and C6 hydroxylated intermediate. | Authors: | Wu, L., Zhou, J.H. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tpu | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-05 |
|
PDBID: | 8z8o | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tq4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8z8z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tq5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8z8p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tq6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8z99 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tq1 | Status: | HPUB -- hold until publication | Title: | HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 | Authors: | Ozorowski, G., Lee, W.H., Ward, A.B. | Deposition date: | 2023-08-06 |
|
PDBID: | 8z8r | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | Authors: | Owuocha, L.F., Beamer, L.J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8z8m | Status: | HPUB -- hold until publication | Title: | Crystal structure of human TNF alpha in complex with TNF30(VHH) domain of ozoralizumab | Authors: | Mima, M., Mishima-Tsumagari, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqj | Status: | HPUB -- hold until publication | Title: | MPI57 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8z8v | Status: | HPUB -- hold until publication | Title: | Crystal structure of human serum albumin in complex with ALB8(VHH) domain of ozoralizumab | Authors: | Mima, M., Mishima-Tsumagari, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tql | Status: | HPUB -- hold until publication | Title: | MPI54 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8z8w | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8z93 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of amyloid fibril formed by human RIPK1 RHIM protein | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8z94 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of RIPK1 RHIM PFFs cross seeded RIPK3 RHIM amyloid fibril | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8z9n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|