| PDBID: | 8rpg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an alcohol oxidase from Streptomyces hiroshimensis | | Authors: | Martinez-Julvez, M., Ferreira, P., Cinca-Fernando, P. | | Deposition date: | 2024-01-15 |
|
| PDBID: | 8zuk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rnk | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8zul | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | | Authors: | Zhang, Z.M., Zhou, Z.Q. | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8zuf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of P.nat ACE2 mutant in complex with MOW15-22 RBD | | Authors: | Tang, J., Deng, Z. | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8zuh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rmy | | Status: | HPUB -- hold until publication | | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | | Authors: | Heggelund, J.E., Sollid, L.M. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8zuw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Bacteroides thetaiotaomicron glutamate decarboxylase | | Authors: | Liu, S., Yulu, W., Guoming, D., Boting, W., Xin, F. | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8zuv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rq7 | | Status: | HPUB -- hold until publication | | Title: | Ku70-Ku80 (Ku) interacting with DNA | | Authors: | Morin, V., Varela, P.F., Charbonnier, J.B. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8zup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8zur | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 9gb9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-30 |
|
| PDBID: | 8zuq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8zus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8zut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rr5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8zux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8zuo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
