PDBID: | 8r6v | Status: | HPUB -- hold until publication | Title: | The complex of glycogen phosphorylase with EGCG (epigallocatechin gallate) and caffeine. | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | Deposition date: | 2023-11-23 |
|
PDBID: | 8r75 | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8r73 | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yi7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 | Sequence: | >Entity 1 LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2 AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3 KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4 CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
PDBID: | 8r71 | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HAdp4 collected at 1.22 A | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yi9 | Status: | HPUB -- hold until publication | Title: | human PRPS2 isoform2 | Authors: | Liu, J.L., Lu, G.M. | Deposition date: | 2024-02-29 |
|
PDBID: | 8r72 | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 collected at 1.33 A | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yih | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8r70 | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yio | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | Deposition date: | 2024-02-29 |
|
PDBID: | 8r6z | Status: | HPUB -- hold until publication | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 2 | Authors: | Cartmell, A. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yij | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8r6x | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-23 |
|
PDBID: | 8yil | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yje | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9fkf | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-03 |
|
PDBID: | 8yj9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9fkc | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-03 |
|
PDBID: | 8r78 | Status: | HPUB -- hold until publication | Title: | Ficin D cystein protease | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | Deposition date: | 2023-11-23 |
|
PDBID: | 8yjb | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8r7h | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-24 |
|
PDBID: | 8yj4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8yjh | Status: | HPUB -- hold until publication | Title: | endogenous state A PCNA-DNA-FEN1 complex | Authors: | Tian, Y., Gao, N. | Deposition date: | 2024-03-01 |
|
PDBID: | 9fkp | Status: | HPUB -- hold until publication | Title: | Zebrafish Betaglycan Orphan Domain (zfBGo) in complex with TGF-B3 and extracellular domains of TGFBRI and TGFBRII | Authors: | Wieteska, L., Coleman, J.A., Hinck, A.P. | Deposition date: | 2024-06-03 |
|
PDBID: | 8r7c | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-24 |
|