| PDBID: | 8qiu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y58 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM21 PRYSPRY (D355A) in complex with acepromazine. | | Authors: | Lu, P., Cheng, Y., Xue, L., Ren, X., Huang, N., Han, T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8qiv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5c | | Status: | HPUB -- hold until publication | | Title: | Structure of Cytochrome P450 CyaI that catalyze imidazolidin formation in alkaloid cyanogramide biosynthesis, in complex with the substrate | | Authors: | Zhang, L.P., Zhu, Y.G., Zhou, J.H., Zhang, C.S. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8qiw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.Coli ABC transporter with ligand | | Authors: | Qiao, Z., Gao, Y.G. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8y5h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.Coli ABC transporter | | Authors: | Qiao, Z., Gao, Y.G. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.Coli ABC transporter with ATP | | Authors: | Qiao, Z., Gao, Y.G. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8qiy | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qix | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjk | | Status: | HPUB -- hold until publication | | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2
AAAA
|
|
| PDBID: | 8y5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of open state ferulic acid decarboxylase from Saccharomyces cerevisiae, F397V/I398L/T438P/P441V mutant | | Authors: | Feng, Y.B., Song, X., Zhu, X.N. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
