PDBID: | 8p12 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Rhodopsin-Gi bound to antibody fragment Fab13 | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | Deposition date: | 2023-05-11 | Release date: | 2024-11-11 |
|
PDBID: | 9eyw | Status: | HPUB -- hold until publication | Title: | Human PRMT5 in complex with AZ compound 21 | Authors: | Debreczeni, J. | Deposition date: | 2024-04-09 |
|
PDBID: | 8x5u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-19 |
|
PDBID: | 8p13 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | Deposition date: | 2023-05-11 | Release date: | 2024-11-11 |
|
PDBID: | 9eyx | Status: | HPUB -- hold until publication | Title: | Human PRMT5 in complex with AZ compound 28 | Authors: | Debreczeni, J. | Deposition date: | 2024-04-09 |
|
PDBID: | 8x67 | Status: | HPUB -- hold until publication | Title: | solution structure of Pru p 7 | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
PDBID: | 8p15 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | Deposition date: | 2023-05-11 | Release date: | 2024-11-11 |
|
PDBID: | 9eot | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-15 |
|
PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 9ez0 | Status: | HPUB -- hold until publication | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-10 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 9ez4 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp5/6 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ez6 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp14/15 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 8x6k | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 9ez9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 8x6j | Status: | HPUB -- hold until publication | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | Deposition date: | 2023-11-21 |
|
PDBID: | 9ezd | Status: | HPUB -- hold until publication | Title: | BsmI (Bottom Nicking mutant) crystallized with Mg2+ and cognate dsDNA (Post-reactive complex) | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | Deposition date: | 2024-04-11 |
|
PDBID: | 8x6n | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 9ezb | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P67S | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | Deposition date: | 2024-04-11 |
|
PDBID: | 9eze | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 8x6o | Status: | HPUB -- hold until publication | Title: | Hemagglutinin in H3N2 influenza viruses | Authors: | Fujii, Y., Sumida, T. | Deposition date: | 2023-11-21 |
|
PDBID: | 8p6p | Status: | HPUB -- hold until publication | Title: | Mycoplasma pneumoniae small ribosomal subunit in chloramphenicol-treated cells | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | Deposition date: | 2023-05-27 | Release date: | 2024-11-27 |
|
PDBID: | 9ezh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|