| PDBID: | 8w8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wlv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P122A_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8wlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DelP123_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wlx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P123A_Msd | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8wm5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8wmb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 9epu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8wm9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 9eqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8wma | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 9eq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8wme | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 9eq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9eqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 9eqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
