| PDBID: | 8r7l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-25 | | Release date: | 2024-11-25 |
|
| PDBID: | 8r1s | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-02 | | Release date: | 2024-11-02 |
|
| PDBID: | 8s0r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8yv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8zb1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-25 | | Release date: | 2025-04-25 |
|
| PDBID: | 8zfh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-07 | | Release date: | 2025-05-07 |
|
| PDBID: | 8z1u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8ywz | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease H163A mutant in complex with Bofutrelvir | | Authors: | Zou, X.F., Wang, W.W., Zhang, J., Li, J. | | Deposition date: | 2024-04-01 | | Release date: | 2025-04-01 |
|
| PDBID: | 8rmc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8z43 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8s6u | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Pab1 in complex with peptide | | Authors: | Devan, S., Shanmugasundaram, S., Muentjes, K., Smits, S.H., Altegoer, F., Feldbruegge, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8z7d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8rps | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8rix | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8r26 | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Mpro (Omicron,P132H) in complex with alpha-ketoamide 13b-K at pH 8.5 | | Authors: | Ibrahim, M., Sun, X., Hilgenfeld, R. | | Deposition date: | 2023-11-03 | | Release date: | 2023-12-01 |
|
| PDBID: | 8zkt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-17 | | Release date: | 2025-05-17 |
|
| PDBID: | 9iqf | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-4 (peptidisc) state | | Authors: | Lan, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqe | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-3 (peptidisc) state | | Authors: | Lan, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqg | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ATP|ADP+Vi-bound Occ (Vi) state | | Authors: | Lan, Y., Jing, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqc | | Status: | HOLD -- hold until a certain date | | Title: | Monooxygenase dependent on riboflavin with dCMP and FAD | | Authors: | Yu, H. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 8z7c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9iqu | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 hydroxylase-XAN60475 | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 9iqw | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 bisphosphate phosphatase | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
