PDBID: | 8xtn | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xu6 | Status: | HOLD -- hold until a certain date | Title: | Study on zinc finger structure and function of tumor suppressor ZMYND11 | Authors: | Bai, X., Chen, Z., Chen, Z. | Deposition date: | 2024-01-12 | Release date: | 2025-01-12 |
|
PDBID: | 8xuk | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-13 | Release date: | 2025-01-13 |
|
PDBID: | 8khh | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-21 | Release date: | 2025-02-21 |
|
PDBID: | 8qa7 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-22 | Release date: | 2024-08-22 |
|
PDBID: | 8xwd | Status: | HOLD -- hold until a certain date | Title: | Croy-EM structure of alpha synuclein fibril with EGCG | Authors: | Li, X., Liu, C. | Deposition date: | 2024-01-16 | Release date: | 2025-01-16 |
|
PDBID: | 8xwo | Status: | HOLD -- hold until a certain date | Title: | Vibrio harveyi chitoporin in complex with minocycline | Authors: | Sanram, S., Suginta, W., Robinson, R.C. | Deposition date: | 2024-01-16 | Release date: | 2025-01-16 |
|
PDBID: | 8xxi | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-18 | Release date: | 2025-01-18 |
|
PDBID: | 8qdg | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-29 | Release date: | 2024-08-29 |
|
PDBID: | 8qdi | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-29 | Release date: | 2024-08-29 |
|
PDBID: | 8xyj | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-19 | Release date: | 2025-01-19 |
|
PDBID: | 8qfu | Status: | HOLD -- hold until a certain date | Title: | Diels-Alderase AbyU mutant - Y76F | Authors: | Tiwari, K., Burton, N.M., Yang, S., Race, P.R. | Deposition date: | 2023-09-05 | Release date: | 2024-09-05 |
|
PDBID: | 8xz0 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz4 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz5 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8ka9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-02 | Release date: | 2024-08-02 |
|
PDBID: | 8y2l | Status: | HOLD -- hold until a certain date | Title: | The Crystal Structure of Glucosyltransferase TcdB from Clostridioides difficile | Authors: | Fan, S., Wei, X., Lv, R., Wang, C., Tang, M., Jin, Y., Yang, Z. | Deposition date: | 2024-01-26 | Release date: | 2025-01-26 |
|
PDBID: | 8jx4 | Status: | HOLD -- hold until a certain date | Title: | Structure of the catalytic domain of pseudomurein endo-isopeptidases PeiW | Authors: | Guo, L.Z., Zhao, N.L., Len, H., Wang, S.X., Cha, G.H., Bai, L.p., Bao, R. | Deposition date: | 2023-06-30 | Release date: | 2024-09-30 |
|
PDBID: | 8y2m | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-26 | Release date: | 2025-01-26 |
|
PDBID: | 8y2t | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 3C protease from coxsackievirus B3 | Authors: | Jiang, H.H., Zou, X.F., Zhang, J., Li, J. | Deposition date: | 2024-01-27 | Release date: | 2025-01-27 |
|
PDBID: | 8k6m | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-25 | Release date: | 2024-07-25 |
|
PDBID: | 8y2u | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 3C protease from coxsackievirus B4 | Authors: | Jiang, H.H., Lin, C., Zhang, J., Li, J. | Deposition date: | 2024-01-27 | Release date: | 2025-01-27 |
|
PDBID: | 8kcv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of UDA01-CAAMDDFQL | Authors: | Tang, Z., Zhang, N. | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8y35 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of amylomaltase from Corynebacterium glutamicum ATCC 13032 | Authors: | Krusong, K., Chek, M.F., Hakoshima, T. | Deposition date: | 2024-01-28 | Release date: | 2025-01-28 |
|