PDBID: | 8wrq | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex | Authors: | Zhang, K., Zhang, X. | Deposition date: | 2023-10-16 | Release date: | 2025-04-16 |
|
PDBID: | 8ws8 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2025-04-16 |
|
PDBID: | 8ws1 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human NEK7 D161N mutant | Authors: | Bijpuria, S., Kanavalli, M., Subbiah, R., Mollard, A., Bearss, D. | Deposition date: | 2023-10-16 | Release date: | 2025-04-16 |
|
PDBID: | 8ukp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-14 |
|
PDBID: | 8uko | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-14 |
|
PDBID: | 8ukn | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-14 |
|
PDBID: | 8wrf | Status: | HPUB -- hold until publication | Title: | Crystal structure of MexL | Authors: | Wei, Y., Wu, Z.K. | Deposition date: | 2023-10-14 | Release date: | 2025-04-14 | Sequence: | >Entity 1 GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
PDBID: | 8qtw | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with (3-(((2-cycloheptylethyl)(methyl)amino)methyl)-1H-indol-7-yl)(methyl)carbamoylated Ser198 | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtx | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with 3-(((2-cycloheptylethyl)(methyl)amino)methyl)-N-methyl-1H-indol-7-amine | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of the FB-bound yeast Ceramide Synthase | Authors: | Schaefer, J., Clausmeyer, L., Koerner, C., Moeller, A., Froehlich, F. | Deposition date: | 2023-10-13 | Release date: | 2024-10-13 |
|
PDBID: | 8qtu | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 and NAD+ | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtv | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 | Release date: | 2025-04-13 |
|
PDBID: | 8qu0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 | Release date: | 2025-04-16 |
|
PDBID: | 8uki | Status: | HPUB -- hold until publication | Title: | Crystal structure of 04_A06 Fab | Authors: | DeLaitsch, A.T., Gristick, H.B., Bjorkman, P.J. | Deposition date: | 2023-10-13 | Release date: | 2025-04-16 |
|
PDBID: | 8ukj | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2023-10-13 |
|
PDBID: | 8ukk | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 |
|
PDBID: | 8ukl | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 |
|
PDBID: | 8wrc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Time-Resolved Ambient Temperature Kineto-Crystallographic Structure of Initiation Factor in Complex with Ribosome | Authors: | DeMirci, H., Yapici, I. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qt1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-5 | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qt4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-6 and NAD+ | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qt0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qt3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-5 and NAD+ | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qt8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a TNFa-Myr analogue TNFn-34 | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qt2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-6 | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-12 |
|
PDBID: | 8qsz | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-12 |
|