PDBID: | 9au9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8uw9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-06 |
|
PDBID: | 9az5 | Status: | HPUB -- hold until publication | Title: | Mycolicibacterium smegmatis ClpS with bound Mg2+ | Authors: | Presloid, C.J., Jiang, J., Beardslee, P.C., Anderson, H.R., Swayne, T.M., Schmitz, K.R. | Deposition date: | 2024-03-10 |
|
PDBID: | 8uwm | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-06 |
|
PDBID: | 9aup | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 9avf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8u1h | Status: | HPUB -- hold until publication | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | Deposition date: | 2023-09-01 |
|
PDBID: | 9av9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8uxz | Status: | HPUB -- hold until publication | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | Deposition date: | 2023-11-11 |
|
PDBID: | 9av4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8uxy | Status: | HPUB -- hold until publication | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | Deposition date: | 2023-11-11 |
|
PDBID: | 9aux | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8uy9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uya | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 9av0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8uy8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 9auy | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 8uy6 | Status: | HPUB -- hold until publication | Title: | Aquaporin Z with ALFA tag and bound to nanobody | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | Deposition date: | 2023-11-13 |
|
PDBID: | 9av1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | Authors: | Harris, S.F., Wu, P. | Deposition date: | 2024-03-01 |
|
PDBID: | 8uy5 | Status: | HPUB -- hold until publication | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | Deposition date: | 2023-11-13 |
|
PDBID: | 9avj | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-03 |
|
PDBID: | 8uz9 | Status: | HPUB -- hold until publication | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | Authors: | Rupert, P.B., Strong, R.K. | Deposition date: | 2023-11-14 | Sequence: | >Entity 1 QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
PDBID: | 9b25 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the ER-alpha Ligand-binding Domain (L372S, L536S) in complex with NA98 | Authors: | Nwachukwu, J.C., Min, C.K., Papa, A., Rangarajan, E.S., Izard, T., Sharma, A., Nettles, K.W. | Deposition date: | 2024-03-14 |
|
PDBID: | 8v36 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9b2b | Status: | HPUB -- hold until publication | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | Deposition date: | 2024-03-14 |
|