| PDBID: | 8uyy | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Preassembled capsid incubated with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 9bgh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS G12D in a transition state mimetic complex with CypA and RMC-7977 | | Authors: | Pourfarjam, Y., Goldgur, Y., Cuevas-Navarro, A., Lito, P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 9bgy | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter, apo conditions, low-affinity state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-16 |
|
| PDBID: | 9bgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uzr | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound CMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 9bgs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uzz | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB03 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 9bgv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9bh2 | | Status: | HPUB -- hold until publication | | Title: | Apo GltPh, outward-facing state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 | | Sequence: | >Entity 1
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLVPR
|
|
| PDBID: | 8v0a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9bh3 | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0e | | Status: | HPUB -- hold until publication | | Title: | ANK repeat of MIB1 | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0d | | Status: | HPUB -- hold until publication | | Title: | Ubch5B-RING3 of MIB1 fusion structure | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9bgu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0c | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB06 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9bgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0b | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB05 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
