| PDBID: | 8zph | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7j | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with compound 20 (CL300) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7h | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase (FSA) from Escherichia coli | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7i | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase, L107C/A129G/R134V/L163C/S166G mutant | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a double mutant of VirB8-like OrfG central and C-terminal domains of Streptococcus thermophilus ICESt3 (Gram positive conjugative type IV secretion system). | | Authors: | Favier, F., Didierjean, C., Maffo-Woulefack, R., Douzi, B., Leblond-Bourget, N. | | Deposition date: | 2024-03-03 |
|
| PDBID: | 8zpt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8s7m | | Status: | HPUB -- hold until publication | | Title: | RosC(R33A) - riboflavin complex | | Authors: | Ermler, U., Mack, M., Warkentin, E. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8zpr | | Status: | HPUB -- hold until publication | | Title: | EcGK filament complexed with proline. | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zpq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-Cov-2-BQ1.1-RBD and 70fab | | Authors: | Wu, Y., Gao, F. | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8s7o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8zpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zpw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zq1 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE4D with isoaurostatin derivatives 1-12 | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zpz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-31 |
|
| PDBID: | 8zq2 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE4D with isoaurostatin derivatives 2-1 | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2024-05-31 |
|
