| PDBID: | 9iwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9b0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9iwg | | Status: | HPUB -- hold until publication | | Title: | crystal structure of xanthine-II ML2/3 in complex with xanthine | | Authors: | Xu, X.C., Ren, A.M. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 8u5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9b0w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8u5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9b1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u62 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers FL | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u64 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, medial PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9b1q | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PYN1 inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, splayed PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9b1c | | Status: | HPUB -- hold until publication | | Title: | CTX-M-15 WT in complex with BLIP E73W | | Authors: | Rivera, P., Lu, S., Palzkill, T., Sankaran, B., Prasad, V. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9b1h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 9b17 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PAN1 inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 9b18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8u77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 9b1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9b1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
