| PDBID: | 8yco | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fcm | | Status: | HPUB -- hold until publication | | Title: | Single-domain antibody binding the SARS-COV2 S2 | | Authors: | Vann Molle, I., Remaut, H. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8qje | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8yct | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fce | | Status: | HPUB -- hold until publication | | Title: | BelI in complex with SAM from Streptomyces sp. UCK14 | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSAQTFEIKGNDLWDPTTFDALRRQLIPSFDLIYEAAVRTVAATVPTAPRVLDLGAGTGLLSAAILRELPDSEVVLVDRSELMLTQARGRFASQDGVTVQTGDLTDPLPEGGFDAVVSGLAIHHLSHTGKRDLFRRIREALRPGGVFVNVEQVQGPLPHLESLYDSQHELHVIREQAPAHEWAAGRERMKFDVCIDLETQLQWLRDAGFRSVDCLAKDFRFATYAGWVS
|
|
| PDBID: | 8yce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fbz | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 1.3 s | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8qjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8ycd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fc0 | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 2.7 s | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8qjv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8ycb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fc1 | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 6.7 s | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8qjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8yca | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fck | | Status: | HPUB -- hold until publication | | Title: | 3D Cryo-EM reveals the structure of a 3-Fmoc zipper motif ensuring the self-assembly of tripeptide nanofiber | | Authors: | Estrozi, L.F., Jierry, L. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8qk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8yc9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fcd | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16) in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8qk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8ycp | | Status: | HPUB -- hold until publication | | Title: | structure of human trpv1 in complex with BC5 | | Authors: | Ke, B.W., Hu, S.L. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fcl | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16) in complex with SAM from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8qjw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8ycv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9fcn | | Status: | HPUB -- hold until publication | | Title: | OPR3 loop swap variant L6(AchrOYE4) in complex with NADPH4 | | Authors: | Bijelic, A., Kerschbaumer, B., Macheroux, P. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
MASHHHHHHMASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRATAGGFLITEGTMISPTSAGFPHVPGIFTKEQVREWKKIVDVVHAKGAVIFCQLWHVGRASHEVYQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTAEADWDDAPDMPEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVMRIKLNAPLNKYNRKTFYTQDPVVGYTDYPFLQGNGSNGPLSRL
|
|
