PDBID: | 9ffp | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8pxq | Status: | HPUB -- hold until publication | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | Deposition date: | 2023-07-24 | Release date: | 2025-01-24 |
|
PDBID: | 8yvc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 9ffq | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8yvi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 9ffr | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8py1 | Status: | HPUB -- hold until publication | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | Deposition date: | 2023-07-24 | Release date: | 2025-01-24 |
|
PDBID: | 8yve | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 9ffs | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8yvf | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 | Sequence: | >Entity 1 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2 MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3 RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
PDBID: | 9fft | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8yvm | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8py4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-25 | Release date: | 2025-01-25 |
|
PDBID: | 8yvn | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvj | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 9ffj | Status: | HPUB -- hold until publication | Title: | Artificial metalloenzyme with a nickel-based 1,10-phenanthroline cofactor and streptavidin N49M-S112V mutant | Authors: | Lau, K., Wang, W., Pojer, F., Larabi, A. | Deposition date: | 2024-05-23 |
|
PDBID: | 8yv7 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | Authors: | Wang, N., Ma, X. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|
PDBID: | 9ffe | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8yvr | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9fgf | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-23 |
|
PDBID: | 8yvs | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 8yvt | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|