| PDBID: | 8q67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9f5i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8y3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 8q69 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | | Authors: | Petit, A.P., Fyfe, P.K. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9f5j | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Q58I | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8y3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 8q6d | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6e | | Status: | HPUB -- hold until publication | | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8y3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9f5m | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of bacteriophage K gp155, native | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8kek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9f5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5o | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of open sTeLIC in detergent, with 4-Bromoamphetamine | | Authors: | Anden, O., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5p | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8kej | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8y3r | | Status: | HPUB -- hold until publication | | Title: | ASFV p72 in complex with Fab H3 | | Authors: | Wang, X., Fu, W., Yu, Q. | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9f5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MGSSHHHHHHSAALEVLFQGPHMWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
|
|
| PDBID: | 9f5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8ken | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 9f60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8kel | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8y3m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9f61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8y41 | | Status: | HPUB -- hold until publication | | Title: | VcFadRqm, mutant protein of Fatty Acid Responsive Transcription Factor from Vibrio cholerae, in Complex with oleoyl-CoA | | Authors: | Tsui, W., Shi, W. | | Deposition date: | 2024-01-30 |
|
