| PDBID: | 9g0q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | | Authors: | Daniel, H. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | | Authors: | Daniel, H. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | | Authors: | Coste, F., Suskiewicz, M.J. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
| PDBID: | 9g0j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BsCdaA in complex with Compound 7 | | Authors: | Neumann, P., Ficner, R. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP | | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0e | | Status: | PROC -- to be processed | | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP in complex with PmcTnsAB hook | | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human Mical1 bMERB_V978A domain:Rab10 complex. | | Authors: | Rai, A., Goody, R.S. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex. | | Authors: | Rai, A., Goody, R.S. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Rhinovirus A2 uncoating intermediate revealing the natural pocket factor (pH 5.8 and 4 degrees Celsius) | | Authors: | Real-Hohn, A., Blaas, D. | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g0a | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g09 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g08 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g06 | | Status: | PROC -- to be processed | | Title: | Structure of 30S-IF1-IF3-mRNA-fMet-tRNA-GE81112A complex | | Authors: | Safdari, H.A., Morici, M., Wilson, D.N. | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g05 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of MadB, a class I dehydrates from Clostridium maddingley, in complex with its substrate | | Authors: | Knospe, C.V., Ortiz, J., Reiners, J., Kedrov, A., Gerten, C., Smits, S.H.J., Schmitt, L. | | Deposition date: | 2024-07-07 |
|
| PDBID: | 9g04 | | Status: | HPUB -- hold until publication | | Title: | Structure of MadB, a class I dehydrates from Clostridium maddingley in the apo state | | Authors: | Knospe, C.V., Ortiz, J., Reiners, J., Kedrov, A., Gertzen, C., Smits, S.H.J., Schmitt, L. | | Deposition date: | 2024-07-06 |
|
| PDBID: | 9g03 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-06 |
|
| PDBID: | 9g02 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-06 |
|
| PDBID: | 9g01 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-06 |
|
