| PDBID: | 9ezr | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 300 ms (P3083) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8p8v | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae di-ribosome in chloramphenicol-treated cells (leading 70S) | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 9ezs | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of free hNQO1 unmixed (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ezt | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 1190ms (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ezu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8joc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-07 | | Release date: | 2024-12-07 |
|
| PDBID: | 9ezv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x7o | | Status: | HPUB -- hold until publication | | Title: | PiB-bound E46K mutanted alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ezw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9f04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x7m | | Status: | HPUB -- hold until publication | | Title: | CR-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9f05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x7r | | Status: | HPUB -- hold until publication | | Title: | C05-03-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8jqa | | Status: | HPUB -- hold until publication | | Title: | Structure of Monkeypox I7 protease in complex with the nonapeptide I-G18 | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-06-13 | | Release date: | 2024-09-30 |
|
| PDBID: | 9f0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x7s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tlr0611 | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-25 |
|
| PDBID: | 9f08 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8pf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-15 | | Release date: | 2024-12-15 |
|
| PDBID: | 9f0a | | Status: | HPUB -- hold until publication | | Title: | N5 Adduct of LSD1-CoREST in complex with MC4455 | | Authors: | Barone, M., Mattevi, A. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
