PDBID: | 9g3v | Status: | HPUB -- hold until publication | Title: | Structure of the human nuclear cap-binding-complex (CBC) | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3u | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. Room temperature data collection | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3t | Status: | HPUB -- hold until publication | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) E153A Y189F from Geobacillus thermodenitrificans | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3s | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3r | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3q | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3p | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 12-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3o | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 24-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3n | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 36-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3m | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase triple-stranded straight tube | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3l | Status: | AUTH -- processed, waiting for author review and approval | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3k | Status: | HPUB -- hold until publication | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 | Sequence: | >Entity 1 ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
PDBID: | 9g3j | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase twisted tube with 28 Angstrom gap between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3i | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase twisted tube with 18 Angstrom gap between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Circularly permuted lumazine synthase twisted tube with no gap between between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3g | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3f | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3e | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3d | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3c | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. 200 K data collection | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3b | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature, 130 K | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3a | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature, 160 K | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g39 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g38 | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE II IN COMPLEX WITH SALVIANOLIC ACID P | Authors: | Alterio, V., De Simone, G. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g37 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|