| PDBID: | 9g3v | | Status: | HPUB -- hold until publication | | Title: | Structure of the human nuclear cap-binding-complex (CBC) | | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. Room temperature data collection | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3t | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) E153A Y189F from Geobacillus thermodenitrificans | | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3p | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase 12-pentamer spherical cage | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3o | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase 24-pentamer spherical cage | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3n | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase 36-pentamer spherical cage | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3m | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase triple-stranded straight tube | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3k | | Status: | HPUB -- hold until publication | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 | | Sequence: | >Entity 1
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
| PDBID: | 9g3j | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase twisted tube with 28 Angstrom gap between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3i | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase twisted tube with 18 Angstrom gap between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Circularly permuted lumazine synthase twisted tube with no gap between between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3c | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. 200 K data collection | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3b | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature, 130 K | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature, 160 K | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g39 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g38 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE II IN COMPLEX WITH SALVIANOLIC ACID P | | Authors: | Alterio, V., De Simone, G. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
