| PDBID: | 9bh4 | | Status: | HPUB -- hold until publication | | Title: | PRMT1 hexamer, Protein Arginine Methyl transferase | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 9bhe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 9bhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9bhf | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 9bhh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Chikungunya virus asymmetric unit with Fab IM-CKV063 | | Authors: | Su, G.C., Galaz-Montoya, J.G., Pintilie, G., Jin, J., Chiu, W. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9bhl | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR65 in complex with miniGs | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9bhm | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR68 in complex with miniGs | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9bhn | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of halichondamide A, a fused bicyclic cysteine knot undecapeptide from the marine sponge Halichondria bowerbanki | | Authors: | Agarwal, V., McShan, A.C., Zhong, W. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9bho | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS G12S in a transition state mimetic complex with CYPA and RMC-7977 | | Authors: | Pourfarjam, Y., Goldgur, Y., Cuevas-Navarro, A., Lito, P. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9bhp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS G12C in a transition state mimetic complex with CYPA and RMC-7977 | | Authors: | Pourfarjam, Y., Goldgur, Y., Cuevas-Navarro, A., Lito, P. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9bhq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS G12A in a transition state mimetic complex with CYPA and RMC-7977 | | Authors: | Pourfarjam, Y., Goldgur, Y., Cuevas-Navarro, A., Lito, P. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8v1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9bhz | | Status: | HPUB -- hold until publication | | Title: | Structure of FbsH, an NRPS adenylation domain in the fimsbactin biosynthetic pathway bound to Salicyl-AMS | | Authors: | Ahmed, S.F., Gulick, A.M. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8v22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9bhy | | Status: | HPUB -- hold until publication | | Title: | Structure of FbsH, an NRPS adenylation domain in the fimsbactin biosynthetic pathway bound to 2,3-dihydroxybenzoic acid. | | Authors: | Ahmed, S.F., Gulick, A.M. | | Deposition date: | 2024-04-22 |
|
