| PDBID: | 9bcn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8uod | | Status: | HPUB -- hold until publication | | Title: | AMPPNP soak crystal structure of human NUAK1-MARK3 kinase domain chimera | | Authors: | Delker, S.L., Abendroth, J. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 9bco | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8uoe | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human NUAK1-MARK3 kinase domain chimera bound with NUAK1 selective inhibitor HTH-01-015 | | Authors: | Delker, S.L., Abendroth, J. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 9bcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8uog | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human NUAK1-MARK3 kinase domain (6 point mutant) chimera with ON123300 small molecule inhibitor | | Authors: | Delker, S.L., Abendroth, J. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 9bd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8uni | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3K4M histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 9bcx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the S. cerevisiae ORC-Cdc6-Mcm2-7-DNA complex with a fully closed Mcm2-Mcm5 DNA entry gate | | Authors: | Yuan, Z., Bai, L., Li, H., Speck, C. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bdf | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8up0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uov | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bd5 | | Status: | HPUB -- hold until publication | | Title: | Laccase from Bacillus licheniformis | | Authors: | Habib, M.H., Smith, T.J. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 8uom | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bdd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8uon | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bdc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8uos | | Status: | HPUB -- hold until publication | | Title: | Designed IL1-R antagonist BB73 | | Authors: | Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8up4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 9bd7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8upa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 9bd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
