PDBID: | 8rb0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8yl5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9ikp | Status: | HPUB -- hold until publication | Title: | Crystal structure of human malectin | Authors: | Si, Y.L. | Deposition date: | 2024-06-28 |
|
PDBID: | 8rb1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rar | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-01 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8yl3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 9fwd | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-29 |
|
PDBID: | 8yks | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbk | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yku | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl6 | Status: | HPUB -- hold until publication | Title: | EDS1-SAG101-NRG1A L134E heterotrimer | Authors: | Wu, X.X., Xiao, Y.Y., Wang, Z.Z., Zhang, Y., Wan, L. | Deposition date: | 2024-03-05 |
|
PDBID: | 8rba | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl7 | Status: | HPUB -- hold until publication | Title: | EDS1-SAG101-NRG1C heterotrimer | Authors: | Wu, X.X., Xiao, Y.Y., Wang, Z.Z., Zhang, Y., Wan, L. | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 1 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbb | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 2 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yln | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rbd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8ylu | Status: | HPUB -- hold until publication | Title: | structure of phage T6 topoisomerase II central domain bound with DNA | Authors: | Chen, Y.T., Xin, Y.H. | Deposition date: | 2024-03-06 |
|
PDBID: | 8rbe | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|