| PDBID: | 8yil | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8ofz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 8yin | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8pq6 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pyogenes GapN in complex with NADPH and glyceraldehyde-3-phosphate | | Authors: | Wirsing, R., Schindelin, H. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 9fi9 | | Status: | HPUB -- hold until publication | | Title: | Human PIF + Z48847594 (OCCUPANCY 0.7) | | Authors: | Bax, B.D., Sanders, C.M., Antson, A.A., Brandao-Neto, J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9fig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8pq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9fid | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8xvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-14 |
|
| PDBID: | 9fie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8yj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8yjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fir | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8pj2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8yj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fis | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8pj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 9fit | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8pj5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8yjh | | Status: | HPUB -- hold until publication | | Title: | endogenous state A PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9fiv | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
