| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8qlx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8qlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8ydk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8ydl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8qlz | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase with covalently attached 4-epi cyclophellitol | | Authors: | Alzahrani, M., Agirre, J., Blaza, J.N. | | Deposition date: | 2023-09-20 | | Sequence: | >Entity 1
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK
|
|
| PDBID: | 8ydz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fe2 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W with bound minocycline | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8kh3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kemp Eliminase HG3.17 in complexed with 5-cyanobenzotriazole | | Authors: | Bunzel, A., Mori, T., Hilvert, D. | | Deposition date: | 2023-08-21 |
|
| PDBID: | 8ydy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fe3 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8khx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-22 |
|
| PDBID: | 8ydx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fe4 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612F | | Authors: | Lazarova, M., Diederichs, K., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8khy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-22 |
|
| PDBID: | 8ye3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human respiratory syncytial virus fusion protein variant | | Authors: | Li, Q.M., Su, J.G., Zhang, J., Liang, Y., Shao, S., Li, X.Y., Zhao, Z.X. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fdt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8ye1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fdz | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the multidrug efflux pump OqxB from Klebsiella pneumoniae | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8khw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-22 |
|
| PDBID: | 8ye2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
