| PDBID: | 8ql4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8yd9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of p38alpha with an allosteric inhibitor 3 | | Authors: | Hasegawa, S., Kinoshita, T. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8yd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-19 |
|
| PDBID: | 9fcz | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with compound 17 (CL301) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ydh | | Status: | HPUB -- hold until publication | | Title: | E.coli transcription translation coupling complex in TTC-P state 1 (subclass1) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ydf | | Status: | HPUB -- hold until publication | | Title: | E.coli transcription translation coupling complex in TTC-B state 1 (subclass 2) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9fde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8yde | | Status: | HPUB -- hold until publication | | Title: | E.coli transcription translation coupling complex in TTC-B state 1 (subclass 3) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8qla | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fd2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fcv | | Status: | HPUB -- hold until publication | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ql2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ydd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8y2v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase C2 | | Authors: | Zhu, D. | | Deposition date: | 2024-01-27 |
|
