| PDBID: | 8pt5 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU187 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xel | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 3 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8pt8 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to RU135 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xen | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 4 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 9f5a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8psr | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to SynthRevD-12-opt artificial peptide | | Authors: | Sok, P., Poti, A., Gogl, G., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xem | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 9f5b | | Status: | HPUB -- hold until publication | | Title: | Identification of zinc ions in LMO4. | | Authors: | El Omari, K., Forsyth, I., Mancini, E.J., Wagner, A. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8pt9 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xeo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MNT antitoxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 9f5j | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Q58I | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8pta | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and Cilengitide TFA complex, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 9f5m | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of bacteriophage K gp155, native | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5o | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of open sTeLIC in detergent, with 4-Bromoamphetamine | | Authors: | Anden, O., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 9f5p | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8xfe | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associated sirtuin 2 (DSR2) H171A protein in complex with DSR anti-defence 1(DSAD1) | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 9f5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 8xew | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 9f6a | | Status: | HPUB -- hold until publication | | Title: | EVA71 E096A native particle | | Authors: | Kingston, N.J., Stonehouse, N.J., Rowlands, D.J., Hogle, J.M., Filman, D.J., Snowden, J.S.S. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8ptt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8xff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein in complex with SPR phage tail tube protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 9f5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MGSSHHHHHHSAALEVLFQGPHMWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
|
|
