| PDBID: | 9ga5 | | Status: | AUCO -- author corrections pending review | | Title: | MtUvrA2 bound to endogenous E. coli DNA | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | XPA crystal grown in HEK293 cell | | Authors: | Melicher, F., Isabet, T., Chavas, L.M.G., Montaville, P. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9gae | | Status: | HOLD -- hold until a certain date | | Title: | Respiratory supercomplex CI1-CIII2-CIV2 from alphaproteobacterium | | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | | Deposition date: | 2024-07-26 | | Release date: | 2025-07-26 |
|
| PDBID: | 9cup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cur | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cul | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-26 | | Release date: | 2025-07-26 | | Sequence: | >Entity 1
MQNGDFQILDYTGLISTMPRVDTLLQSMNLFTEHFGRTTVARIERLDDGAGDIKAVQRGGVRQHLANDRKKIVNLNIPFFPLDRSIDRADIQNFREFGTENAPATVDAEVQRHMARIRRSHAILKSKAMYAALKGTSWSPDDPVSDYNYYDVWGATQTTADVDFTKLGVDPIEVLEAEARAHIIDWAGDNGDNYEIVVLASRQWFSALIAHPQVTGAYSQYPSTQEILRRRLGGNANNRIFEHKNILFIEDISGNIPAGEAYIFPRGISRMFEIYYAPSDTLRDANQAAQELYVFFKESNYLREAKIESETSFLTVNNRPELVVKSTGKFTA
>Entity 2
MAKAHVATLEGNYSDIVLGRVVAFGDTGWNFKEVDMTFIADDADADSKTTLFAGVLVGEDGTPATAAAGVFGVLVDRKVLPGVDHYIGVFEPGEKVPMVLAVRGLTLNQLKLKYADGTAIDAAGIQALEAQGNQVTDKIVGTQFIGSVL
|
|
| PDBID: | 9cum | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuq | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of HCV E2 hypervariable region 1 peptide in complex with bound antibody | | Authors: | Mian, M.I., Janus, B.M., Ofek, G.O. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cua | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cun | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cub | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cug | | Status: | HPUB -- hold until publication | | Title: | X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain | | Authors: | Seo, H.-S., Agius, M.P., Dhe-Paganon, S. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuf | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Room temperature SSX structure of ccNiR | | Authors: | Malla, T.N., Schmidt, M. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cud | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cue | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
