| PDBID: | 9gbr | | Status: | HPUB -- hold until publication | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG17 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbg | | Status: | HPUB -- hold until publication | | Title: | Putative Phage Recombinase UvsX | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gc0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 9gbs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG18 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gby | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-07-31 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9iyw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxt | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin A/Hong Kong/1/68 produced in GnTI- cells | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxu | | Status: | HPUB -- hold until publication | | Title: | Endo H-treated hemagglutinin A/Hong Kong/1/68 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxb | | Status: | HPUB -- hold until publication | | Title: | Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly | | Authors: | Jia, Z., Ryan, H., Colleen, N. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
