| PDBID: | 9cy0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-4206 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy3 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing Atorvastatin-bound OATP1B1 with sybody Sb5 | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy4 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing cyclosporine A-bound OATP1B1 with sybody 5 (Sb5) | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 main protease in complex with TMP1 | | Authors: | Deng, X.Y., Zeng, R., Yang, S.Y., Lei, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9izo | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D336A of acarbose hydrolase from human gut flora K. grimontii TD1, complex with acarviosine | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9ize | | Status: | HPUB -- hold until publication | | Title: | Acarbose hydrolase from human gut microbiota K. grimontii TD1, Apg mutant enzyme D336A, complexed with acarviosine-glucose | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9iza | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9izd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izl | | Status: | HPUB -- hold until publication | | Title: | hVanin-1 complexed with X17 | | Authors: | Fan, S., Zhen, L., Xie, T. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
GSTVSAEDKAAAERSKEIDKCLSREKTYVKRLVKILLLGADNSGKSTFLKQMRIIHGGSGGSGGTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVDSSDFNRLTESLNDFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENARLIFRDVKDTILHDNLKQLMLQ
>Entity 2
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELK
>Entity 3
MHHHHHHHHENLYFQGSSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNGGSGGGGSGGSSSGGVSGWRLFKKIS
>Entity 4
SNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
>Entity 5
MKTIIALSYIFCLVFADYKDDDDGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLGGSGGGGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS
|
|
