PDBID: | 9jn0 | Status: | PROC -- to be processed | Deposition date: | 2024-09-22 |
|
PDBID: | 9jn8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-22 |
|
PDBID: | 9jmz | Status: | PROC -- to be processed | Deposition date: | 2024-09-22 |
|
PDBID: | 9jmy | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-09-22 | Release date: | 2025-09-22 |
|
PDBID: | 9jn3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of AvpGT in complex with Ara-A | Authors: | Li, J.H., Wang, Z.Q., Zhang, Z.Y., Chen, W.Q. | Deposition date: | 2024-09-22 |
|
PDBID: | 9jn4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-22 | Release date: | 2025-09-22 |
|
PDBID: | 9jn5 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-22 | Release date: | 2025-09-22 |
|
PDBID: | 9jn6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-22 | Release date: | 2025-09-22 |
|
PDBID: | 9jn1 | Status: | PROC -- to be processed | Deposition date: | 2024-09-22 |
|
PDBID: | 9jn2 | Status: | PROC -- to be processed | Title: | Multidrug resistance-associated protein 2 in complex with AMP-PNP in active state | Authors: | Chen, D.D., Zhao, P. | Deposition date: | 2024-09-22 |
|
PDBID: | 9jn7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK783 | Authors: | Sakai, N., Mishima-Tsumagari, C., Shirouzu, M. | Deposition date: | 2024-09-22 |
|
PDBID: | 9dpm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-22 |
|
PDBID: | 9dpl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-22 |
|
PDBID: | 9gv3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the complex between Nb474 mutant R53A,D125A and Trypanosoma congolense fructose-1,6-bisphosphate aldolase | Authors: | McNae, I.W., Dornan, J., Walkinshaw, M.D. | Deposition date: | 2024-09-21 |
|
PDBID: | 9gv4 | Status: | HPUB -- hold until publication | Title: | TBA G-quadruplex binding nanobody (free form) | Authors: | Pevec, M., Hadzi, S. | Deposition date: | 2024-09-21 | Sequence: | >Entity 1 QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
PDBID: | 9jmx | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-21 | Release date: | 2025-09-21 |
|
PDBID: | 9jmw | Status: | PROC -- to be processed | Deposition date: | 2024-09-21 |
|
PDBID: | 9dpe | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-21 |
|
PDBID: | 9jmq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-21 |
|
PDBID: | 9jmt | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-21 |
|
PDBID: | 9jmu | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-21 |
|
PDBID: | 9jmv | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-21 |
|
PDBID: | 9jmr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of PRV gB and FAB 16f9 complex | Authors: | Li, Y., Zheng, Q., Li, S. | Deposition date: | 2024-09-21 |
|
PDBID: | 9jms | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of VZV gB and FAB 16F9 complex | Authors: | Li, Y., Zheng, Q., Li, S. | Deposition date: | 2024-09-21 |
|
PDBID: | 9dpf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of TMPRSS11D S368A complexed with its own zymogen activation motif | Authors: | Fraser, B.J., Dong, A., Ilyassov, O., Seitova, A., Li, Y., Edwards, A., Benard, F., Arrowsmith, C., Structural Genomics Consortium (SGC) | Deposition date: | 2024-09-21 |
|