| PDBID: | 8zc7 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic analysis of MitM, which catalyzes the post-mitosane modification in mitomycin biosynthesis | | Authors: | Xia, M., Dong, D. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8zc8 | | Status: | HPUB -- hold until publication | | Title: | The structure of MitM and mitomycin A with SAH in mitomycin | | Authors: | Xia, M., Dong, D. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f4c | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of CKAP5/chTOG | | Authors: | Pfuhl, M. | | Deposition date: | 2024-04-27 | | Sequence: | >Entity 1
ASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRP
|
|
| PDBID: | 8zbp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of SARS-CoV-2 main protease in complex with Compound ZM_097 | | Authors: | Zhao, Y. | | Deposition date: | 2024-04-27 |
|
| PDBID: | 8zbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-27 |
|
| PDBID: | 8zbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-27 |
|
| PDBID: | 8zbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-27 |
|
| PDBID: | 8zbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-27 |
|
| PDBID: | 9f4b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8zb3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with NAD | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with AMP | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of outward state Anhydromuropeptide permease (AmpG) G50W/L269W | | Authors: | Yoo, Y., Chang, N., Kim, U., Kim, H., Cho, H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Persulfide Dioxygenase from Beggiatoa leptomitoformis | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Rudenko, T.S. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb2 | | Status: | HPUB -- hold until publication | | Title: | L-Methionine oxidase from Burkholderiales bacterium | | Authors: | Kawamura, Y., Chisuga, T., Nakano, S. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbl | | Status: | HPUB -- hold until publication | | Title: | Glycosidated glycyrrhetinic acid derivative as a soluble epoxide hydrolase inhibitor | | Authors: | Wang, H., Feng, Y., Ge, Z.H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbm | | Status: | HPUB -- hold until publication | | Title: | RAT skeletal muscle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
