| PDBID: | 8pkn | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of catalytic domain of human HMG-CoA reductase with its inhibitor atorvastatin | | Authors: | Manikandan, K., Van Rooyen, J. | | Deposition date: | 2023-06-27 | | Release date: | 2025-01-03 |
|
| PDBID: | 8tas | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-27 | | Release date: | 2024-12-18 |
|
| PDBID: | 8jum | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-26 | | Release date: | 2024-12-31 |
|
| PDBID: | 8t9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-24 |
|
| PDBID: | 8t9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-23 | | Release date: | 2024-12-18 |
|
| PDBID: | 8pis | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8pio | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8pir | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8jtq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8jtu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-09-24 |
|
| PDBID: | 8pin | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 8t8j | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-18 |
|
| PDBID: | 8pik | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8jti | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8t7r | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8jsq | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-09-25 |
|
| PDBID: | 8phh | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | | Authors: | Byrne, M.J., Sainsbury, F. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8jse | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8jsa | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8phc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8js2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8jry | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-06-18 |
|
| PDBID: | 8pg1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-17 | | Release date: | 2024-12-17 |
|
