| PDBID: | 8um5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human SHIP1 Ptase-C2 domains covalently bound to TREAT-AD (TAD) compound TAD-58547 | | Authors: | Mesecar, A.D., Hamdani, A.K. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
SMEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHHGELTGHFQGEIKLQTSQ
|
|
| PDBID: | 8umf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8umi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 1 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 1 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 2 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wse | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 2 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 3 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsj | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.5 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsr | | Status: | HPUB -- hold until publication | | Title: | the structure of BtSY1_RBD/hACE2 protein | | Authors: | Xu, Z.P., Sun, J.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wt0 | | Status: | HOLD -- hold until a certain date | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 3 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8ws9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM mini structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsh | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=4.0 | | Authors: | Zhou, X.L., Jiang, H.H., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.0 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=8.5 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
