PDBID: | 8z2l | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253E from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdl | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdn | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdp | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdm | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdo | Status: | HPUB -- hold until publication | Title: | Crystal structure of anti-abTCR NANOBODY VHH | Authors: | Qiu, Y. | Deposition date: | 2024-04-12 |
|
PDBID: | 9bds | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-12 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9bdt | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdk | Status: | HPUB -- hold until publication | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-12 |
|
PDBID: | 9ezc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 9eza | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 | Release date: | 2025-04-11 |
|
PDBID: | 9ez9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 9ezd | Status: | HPUB -- hold until publication | Title: | BsmI (Bottom Nicking mutant) crystallized with Mg2+ and cognate dsDNA (Post-reactive complex) | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | Deposition date: | 2024-04-11 |
|
PDBID: | 9ezb | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P67S | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | Deposition date: | 2024-04-11 |
|
PDBID: | 9eze | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1k | Status: | AUTH -- processed, waiting for author review and approval | Title: | P ring on polyrod-P ring complex from Salmonella typhimurium HK26292 mutant | Authors: | Yamaguchi, T., Kato, T., Minamino, T., Namba, K. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1h | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | Authors: | Lin, C., Zhang, J., Li, J. | Deposition date: | 2024-04-11 | Release date: | 2025-04-11 |
|
PDBID: | 8z1g | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ELAC2-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1i | Status: | HPUB -- hold until publication | Title: | Crystal structure of the isomerase Art22 | Authors: | Guo, L., Li, P.W., Li, D.F., Chen, Y.H. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1d | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|