| PDBID: | 9gwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw6 | | Status: | HPUB -- hold until publication | | Title: | Lys9DabMC6*a 2-Delta | | Authors: | Maglio, O., Lombardi, A., Chino, M., Pirro, F. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-carboxysome T=4 mini-shell containing CTD only mutant of CsoSCA | | Authors: | Ng, P.C., Basle, A., Marles-Wright, J., Liu, L. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpg | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jph | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-26 | | Release date: | 2025-09-26 |
|
| PDBID: | 9jpx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drw | | Status: | HPUB -- hold until publication | | Title: | Myocilin OLF mutant A427T | | Authors: | Scelsi, H.F., Lieberman, R.L. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
LKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVTNAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
|
|
