| PDBID: | 9k2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 3 (MC3R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 5 (MC5R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k35 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a (R)-selective transaminase (RTA) from Sphingopyxis sp. | | Authors: | Qin, F.Y., Lee, K.M., Wong, K.B., Lee, K.H. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Preload capsid of phiYY, a prokaryotic dsRNA virus | | Authors: | Huyan, Y.N., Meng, G. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k37 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2y | | Status: | HPUB -- hold until publication | | Title: | Human IgG1 Fc fragments, mutant (2CT1.1) | | Authors: | Kim, J.-S., Kim, J.-W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k34 | | Status: | HPUB -- hold until publication | | Title: | Human IgG1 Fc fragments, mutant (2CT1.9) | | Authors: | Kim, J.-S., Kim, J.-W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | | Deposition date: | 2024-10-18 | | Sequence: | >Entity 1
(MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
| PDBID: | 9h4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9h4f | | Status: | HPUB -- hold until publication | | Title: | Structure of Imine Reductase 361 from Micromonospora sp. mutant M125W/I127F/L179V/H250L | | Authors: | Ho, E., Domenech, J., Crossley, A., Green, A.P., Grogan, G. | | Deposition date: | 2024-10-18 |
|
