| PDBID: | 9h6p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NUDT14 complexed with novel compound AMNUDT14-003 in spacegroup P1 | | Authors: | Balikci, E., Koekemoer, L., Dlamini, L.S., Gurav, N., Apostolidou, M., Adcock, C., McGown, A., Marques, A.M.C., Spencer, J., Huber, K.V.M., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLDLQ
|
|
| PDBID: | 9h6l | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6k | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP-GalNac | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h69 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h63 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h5v | | Status: | HPUB -- hold until publication | | Title: | Apo human mitochondrial Hsp60 (C1) | | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h5w | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Hydrogenosomal processing peptidase (HPP), E56Q inactive mutant, from Trichomonas vaginalis co-crystallized with presequence peptide from adenylate kinase (AK) - not visible in the structure model | | Authors: | Motlova, L., Samad, A., Cianci, M., Barinka, C. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h5x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human V122I transthyretin in complex with (3,4-dihydroxy-5-nitrophenyl)-(3-fluoro-5-hydroxyphenyl)methanone compound | | Authors: | Varejao, N., Pinheiro, F., Pallares, I., Ventura, S., Reverter, D. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human V30M transthyretin in complex with (3,4-dihydroxy-5-nitrophenyl)-(3-fluoro-5-hydroxyphenyl)methanone compound | | Authors: | Varejao, N., Pinheiro, F., Pallares, I., Ventura, S., Reverter, D. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h65 | | Status: | HPUB -- hold until publication | | Title: | Steroidal Selective Modulators of FXR with Therapeutic Potential | | Authors: | Kydd-Sinclair, D., Watson, K.A. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h66 | | Status: | HPUB -- hold until publication | | Title: | Steroidal Selective Modulators of FXR with Therapeutic Potential | | Authors: | Kydd-Sinclair, D., Watson, K.A. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h60 | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-23 | | Sequence: | >Entity 1
MPAGMSAAAGKTLADYKAPYPKPTSRQRRYVILLDPKGDNAELNDYKVELIPGRVKLLDGANHYFLGGKIEEKTIDGWGYPYYVVTLAEMAGTAMLPLGNAAHKKLRFVPLRTSSLYRYNSKLPIVVYVPKDGVLRYRIWTAKLSGRGKAKSIKAKEM
>Entity 2
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
|
|
| PDBID: | 9h5r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Trichomonas vaginalis inactive mutant hydrogenosomal processing peptidase heterodimer (HPPin) | | Authors: | Samad, A., Cianci, M., Motlova, L., Barinka, C. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k77 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB from Mycobacterium tuberculosis complexed with AM-152C | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k78 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB from Mycobacterium tuberculosis complexed with AM-152E | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k79 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB from Mycobacterium tuberculosis complexed with AM-152J | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9k74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-23 |
|
