| PDBID: | 8r3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8uwz | | Status: | HPUB -- hold until publication | | Title: | The structure of Raamsizumab in complex with VEGF121 | | Authors: | Singer, A.U., Bruce, H., Blazer, L., Sicheri, F., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux6 | | Status: | HPUB -- hold until publication | | Title: | Structure of Fab B11 with a T. parva sporozoite neutralizing B cell epitope of p67 | | Authors: | Singer, A.U., Gopalsamy, A., Fellouse, F.A., Miersch, S., Sidhu, S.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8uwt | | Status: | HPUB -- hold until publication | | Title: | A X-ray Crystallographic Structure Model of a Glycoside Hydrolase (GH) Family 39 (GH39)-like Enzyme Encoded within a Xylan Utilization Locus of the pSOL1 Megaplasmid of Clostridium acetobutylicum | | Authors: | St John, F.J., Fujimoto, Z. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MATTLTVDCRATLRGVTHCASGSLYGVTESKPFDINQFVAPLKPNVFTNPALAGFNHQQPIGAAIPTAGRLKNTTGKVMIRLADIFPRWPYGFTNMNDWLGKVTSVINQKKASGYSNFYGYEIWNEPDGTFKNNNVSFNDMWLQTYKLIRRLDPNSQIIGPSYSYYNHYNMNAFLNFCRANNCLPDVICWHELGGSQNISGNIRDLKTLERSLGIPERKIAINEYSDSNHYAEGQPGASAPFIAKFERNKVDSACISWWWTNAPGRLGSLMASDTQKGAGWWFYKWYGDMTGNMVNVIPQNDNSNLADGFACVDSNAKYISVLLGGVNDGTVNVNIKNIPAFIGSSATVKVEKVDWNGKDTPVNGTNTVFSKRYTVSNGTINVSIPGTNNTSGYRVYVSRLEHHHHHH
|
|
| PDBID: | 8ux4 | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial ribosome of saccharomyces cerevisiae class II from YEP with Dextrose culture | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 8x1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-07 | | Release date: | 2024-11-07 |
|
| PDBID: | 8r2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2q | | Status: | HPUB -- hold until publication | | Title: | Mycobacterium tuberculosis fatty acyl CoA synthetase, FadD5 | | Authors: | Rahman, M.A., Dalwani, S., Venkatesan, R. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2r | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of the Mycobacterium tuberculosis fatty acyl CoA synthetase, FadD5 | | Authors: | Rahman, M.A., Dalwani, S., Venkatesan, R. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2p | | Status: | HPUB -- hold until publication | | Title: | YZwIdeal x16 a scaffold for cryo-EM of small proteins of interest crystallizing in space group 19 (P 21 21 21) | | Authors: | Moche, M., Friberg, O., Nygren, P.A., Nilvebrant, J. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2s | | Status: | HPUB -- hold until publication | | Title: | Heme-dependent l-tyrosine hydroxylase (TyrH) from Streptomyces sclerotialus: fourfold mutant | | Authors: | Carraretto, D., Mattevi, A. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
