| PDBID: | 9dd6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9ddc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl4 | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the freshwater actinorhodopsin, Rhodoluna lacicola (RlActR) | | Authors: | Djabeur, N., Jeckelmann, J.-M., Fotiadis, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Deacetylase (HdaH) from Klebsiella pneumoniae subsp. ozaenae | | Authors: | Qin, C., Graf, L.G., Schulze, S., Palm, G.J., Lammers, M. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gla | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TRPC5 in complex with spin-labelled ligand SpinPico3 | | Authors: | Porav, S.A., Bon, R.S., Hammond, K.L.R. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 |
|
| PDBID: | 9gl7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of UFC1 T106S | | Authors: | Kumar, M., Banerjee, S., Wiener, R. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gli | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gll | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of UFC1 W145F | | Authors: | Kumar, M., Banerjee, S., Wiener, R. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gln | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gle | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Jumonji domain-containing protein 2A with crystallization epitope mutations A91T:T93S | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gld | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of p73 tetramerisation domain in complex with darpins 1800 | | Authors: | Chaikuad, A., Strubel, A., Doetsch, V., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-08-27 |
|
