| PDBID: | 9jpg | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jph | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-26 | | Release date: | 2025-09-26 |
|
| PDBID: | 9drw | | Status: | HPUB -- hold until publication | | Title: | Myocilin OLF mutant A427T | | Authors: | Scelsi, H.F., Lieberman, R.L. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
LKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVTNAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
|
|
| PDBID: | 9ds0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo-241_2F04 Fab | | Authors: | Lin, T.H., Wilson, I.A. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9dsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw5 | | Status: | HPUB -- hold until publication | | Title: | type-I interferon autoantibodies pmab3, pmab19 and pmab14 in complex with Interferon alpha-2 | | Authors: | Duquerroy, S., Rey, F., Mahevas, M., Chappert, P., Ahouzi, O. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
