| PDBID: | 9e6o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4-Ccw5 complex | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Locally Refined Cryo-EM map of 2G12 IgG BCR receptor lacking Fab region view | | Authors: | Thakur, B., Acharya, P. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9h8y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of alpha-crustacyanin from Homarus americanus | | Authors: | Cianci, M., Cedri, M.C., Amici, A., Collet, T., McCarthy, A., Mueller-Dieckmann, C. | | Deposition date: | 2024-10-29 | | Sequence: | >Entity 1
DKIPDFVVPGKCASVDRNKLWAEQTPNRNNYAGVWYQFALTNNPYQLIEKCVRNEYSFDGEQFVITSTGIAYDGNLLKRNGKLYPNPFGEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSFIFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCPYDTQKTL
>Entity 2
DGIPSFVTAGKCASVANQDNFDLRRYAGRWYQTHIIENAYQPVTRCINSNYEYSGNDYGFKVTTAGFNPNDEYLKIDFKVYPTKEFPAAHMLIDAPSVFAAPYEVIETDYETYSCVYSCITTDNYKSEFAFVFSRTPQTSGPAVEKCAAVFNKNGVEFSKFVPVSHTAECVYRA
>Entity 3
LNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAQALPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVD
|
|
| PDBID: | 9h8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8h | | Status: | HPUB -- hold until publication | | Title: | Structure of DC11 anti tau antibody Fab fragment | | Authors: | Cehlar, O., Njemoga, S. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Nkp46 in complex with a bicyclic peptide BCY00016132 | | Authors: | Pellegrino, S., Carr, K., Bezerra, G.A. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8w | | Status: | HPUB -- hold until publication | | Title: | Leishmania donovani ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h95 | | Status: | HPUB -- hold until publication | | Title: | YnaI in closed conformation purified in DDM with additional lipids showing ligand-filled pockets | | Authors: | Flegler, V.J., Bottcher, B., Rasmussen, T., Rasmussen, A., Hedrich, R. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8g | | Status: | HPUB -- hold until publication | | Title: | Complex 5 30S-GE81112 | | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h8x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Composite map for cryo-EM structure of alpha-crustacyanin from Homarus americanus | | Authors: | Cedri, M.C., Cianci, M., Bansia, H., Amici, A., Wang, T., des Georges, A. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9kaw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 PT Spike Protein complex with a potent broad-spectrum macrocyclic peptide inhibitor 6L3-3P11K | | Authors: | Wang, M., Yang, J.Y., Peng, Q., Shi, Y. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9kao | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9kal | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9kaq | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Peroxiredoxin I in complex with Salvianolic Acid A | | Authors: | Zhang, H., Xu, H., Luo, C. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9kav | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e6a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e63 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
