| PDBID: | 9gca | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C8H8N2O | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9gcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3367 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3765 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3764 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-4051 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3763 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hc9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3762 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 7hca | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-4636 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 main protease in complex with TMP1 | | Authors: | Deng, X.Y., Zeng, R., Yang, S.Y., Lei, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izo | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D336A of acarbose hydrolase from human gut flora K. grimontii TD1, complex with acarviosine | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9ize | | Status: | HPUB -- hold until publication | | Title: | Acarbose hydrolase from human gut microbiota K. grimontii TD1, Apg mutant enzyme D336A, complexed with acarviosine-glucose | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
GSTVSAEDKAAAERSKEIDKCLSREKTYVKRLVKILLLGADNSGKSTFLKQMRIIHGGSGGSGGTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVDSSDFNRLTESLNDFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENARLIFRDVKDTILHDNLKQLMLQ
>Entity 2
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELK
>Entity 3
MHHHHHHHHENLYFQGSSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNGGSGGGGSGGSSSGGVSGWRLFKKIS
>Entity 4
SNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
>Entity 5
MKTIIALSYIFCLVFADYKDDDDGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLGGSGGGGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS
|
|
| PDBID: | 9izi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izr | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izs | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9j00 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
