| PDBID: | 9iq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9ipv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g33 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g2i | | Status: | HPUB -- hold until publication | | Title: | 25-phosphosteroid lyase + phosphate | | Authors: | Ermler, U., Boll, M., Demmer, U., Jacoby, C. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g2q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ips | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRM1 in complex with shark VNAR-3108 | | Authors: | Cui, Y.Z., Li, H.M., Tong, J.Y., Tong, Z., Qi, J.X., Gao, G.F. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CTB10-M1 | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipn | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone and incubated shortly | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of MERS main protease in complex with carmofur | | Authors: | Guo, L., Zhou, X.L., Zeng, P., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2024-07-11 | | Release date: | 2025-07-11 |
|
| PDBID: | 9ipo | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipm | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 20-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clh | | Status: | HPUB -- hold until publication | | Title: | X-ray diffraction structure of the apo form of papain | | Authors: | Vlahakis, N.W., Rodriguez, J.A. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Transferrin Binding Protein A in complex with transferrin binding protein B and two molecules of transferrin | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9cle | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g24 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
