| PDBID: | 9e8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9e8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9hao | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9han | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9haq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methionine gamma-lyase from Brevibacterium sandarakinum in complex with PLP and norleucine at pH 8.5 | | Authors: | Kopecny, D., Ferchaud, N., Briozzo, P. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of TRP14 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kea | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LnzB (Streptomyces spp. ) | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kee | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9ke7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 23 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9keb | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 24 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9ked | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of spiny eel influenza-like virus HA | | Authors: | Sun, J.Q., Zhang, D. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kec | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 25 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9ke2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SxRhaGT in complex with TDP | | Authors: | Tingting, Y., Tingting, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 80S ribosome | | Authors: | Lu, Y., Wang, X., Qin, Y., Cao, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ScRhaGT in complex with TDP | | Authors: | Tingting, Y., Tingting, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of HdNadV and its complex with NMN | | Authors: | Lin, T., Zhengjuan, W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation in complex with GSH | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdr | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of TrkA kinase in complex with RT1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
