| PDBID: | 9bea | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f03 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | mRhubarb720-WT | | Authors: | Aksakal, O., Rizkallah, P.J., Warren, A., Lipka-Lloyd, M., Jones, D.D. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f0b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-15 | | Release date: | 2025-04-15 |
|
| PDBID: | 9f08 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f02 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f09 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f0a | | Status: | HPUB -- hold until publication | | Title: | N5 Adduct of LSD1-CoREST in complex with MC4455 | | Authors: | Barone, M., Mattevi, A. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gq complex in pH6.5 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.6 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the receptor of hGPR68-Gs complex in pH6.0 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3c | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase family protein | | Authors: | Hwang, J., Lee, J.H., Do, H. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
